« Back
Home /
Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Human
Amount	1mg
Item no.	BM-RPC22018-1mg
eClass 6.1	34160400
eClass 9.0	42020190
Available
Estimated Turnaround Time	6-11 business days
UniProt ID	P31639
Gene Name	SLC5A2
Alternative Names	Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2
Source	E.coli
Expression Region	1-102aa
AA Sequence	MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLL VIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGAS LFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Sequence Info	Partial Length
Tag	N-terminal 10x His Tag and C-terminal Myc Tag
Theoretical MW	15.5 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 6/27/2024