« Back
Home /
Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial

Recombinant Mouse Glucagon-like peptide 1 receptor (Glp1r), partial

Manufacturer	Biomatik
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	Mouse
Amount	100ug
Item no.	BM-RPC20276-100ug
Targets	GCG ;;GLP1R
eClass 6.1	34160400
eClass 9.0	42020190
Available
UniProt ID	O35659
Gene Name	Glp1r
Alternative Names	Short name:, GLP-1 receptor, Short name:, GLP-1-R, Short name:, GLP-1R
Source	E.coli
Expression Region	22-145aa
AA Sequence	GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLL ATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSEC EESKRGERNFPEEQLLSLY
Sequence Info	Extracellular Domain
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	30.38kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024