« Back
Home /
Recombinant Marmota monax Interferon gamma (IFNG)

Recombinant Marmota monax Interferon gamma (IFNG)

Manufacturer	Biomatik
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins
Specific against	other
Amount	1mg
Item no.	BM-RPC20316-1mg
Targets	IFNG
eClass 6.1	34160400
eClass 9.0	42020190
Available
UniProt ID	O35735
Gene Name	IFNG
Alternative Names	Short name:, IFN-gamma
Source	Yeast
Expression Region	24-166aa
AA Sequence	QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDK WKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKI QRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK
Sequence Info	Full Length
Tag	N-terminal 6xHis-tagged
Theoretical MW	18.59kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 6/27/2024