« Back
Home /
Recombinant Absidia glauca Actin-1 (ACT1), partial

Recombinant Absidia glauca Actin-1 (ACT1), partial

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Amount	100ug
Item no.	BM-RPC22426-100ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Estimated Turnaround Time	6-11 business days
UniProt ID	P10982
Gene Name	ACT1
Source	E.coli
Expression Region	1-140aa
AA Sequence	MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPS IVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLR YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPV LLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Sequence Info	Full Length
Tag	N-terminal 6x His Tag and C-terminal Myc Tag
Theoretical MW	21.2 kDa
Purity	> 85% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024