« Back
Home /
Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

Recombinant Sulfolobus solfataricus DNA-binding protein 7d (sso7d)

Manufacturer	Biomatik
Category	Oncology Neuroscience Neural Development By Cell Type Blastoma Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Amount	50ug
Item no.	BM-RPC22560-50ug
Targets	GLI3;;TNFRSF14
eClass 6.1	34160400
eClass 9.0	42020190
Available
Estimated Turnaround Time	3-5 weeks
UniProt ID	P39476
Gene Name	sso7d
Alternative Names	7KDA DNA-binding protein dSso7d
Source	E.coli
Expression Region	2-64aa
AA Sequence	ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDE GGGKTGRGAVSEKDAPKELLQMLEKQKK
Sequence Info	Full Length
Tag	N-terminal 6x His-SUMO Tag
Theoretical MW	23.1 kDa
Purity	> 90% by SDS-PAGE

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024