« Back
Home /
Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease (nucB)

Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease (nucB)

Item no.	BM-RPC25175-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Purity	> 85% by SDS-PAGE
Sequence	SYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTID RDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGG AGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLF IVQ
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	No Tag
Molecular Weight (Theoretical)	12 kDa
Expression Region	29-136aa
Manufacturer - Gene Name	nucB
Sequence Information	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer