« Back
Home /
Recombinant Rat Protein S100-A9 (S100a9)

Recombinant Rat Protein S100-A9 (S100a9)

Manufacturer	Biomatik
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Targets for Rodent Neurosciences By Cell Type Melanoma Peptides & Proteins Recombinant Proteins Cytoskeleton Markers
Type	Proteins
Specific against	Rat
Amount	50ug
Item no.	BM-RPC20382-50ug
Targets	S100B
eClass 6.1	34160400
eClass 9.0	42020190
Available
UniProt ID	P50116
Gene Name	S100a9
Alternative Names	Calgranulin-B, Migration inhibitory factor-related protein 14, Short name:MRP-14, Short name:p14, Myeloid-related protein 14, S100 calcium-binding protein A9
Source	E.coli
Expression Region	2-113aa
AA Sequence	AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKA EFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQ DNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHS HGKGCGK
Sequence Info	Full Length
Tag	N-terminal 6xHis-SUMO-tagged
Theoretical MW	28.32kDa
Purity	>= 90%
Storage Instructions	Aliquot and store at -20C. Minimize freezing and thawing.
Expiry Date	1 year
Shipping Condition	Blue ice
Restriction	For research use only. Not for diagnostic procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024