Comparison

Mouse recombinant IL-17D (Interleukin-17D) protein, AF European Partner

Item no. BOS-PROTA0A0B4J1G4-5ug
Manufacturer Boster
Amount 5 ug
Quantity options 100 ug 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Mouse (Murine, Mus musculus)
Conjugate/Tag HIS
Sequence ALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAYCLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEPDKSAZDSANSSMDKLLLGPADRPAGR with polyhistidine tag at the N-terminus.
Alias AI462269
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 20.74 kDa.
The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 20.74 kDa.The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
Il17d
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Interleukin 17D (IL-17D) belongs to the IL-17 family of cytokines, predicts a molecular mass of 20 kDa. IL-17 family is closely linked to host defense and immune response, and IL-17D is a novel cytokine in the IL-17 family of cytokines that has not been extensively investigated. It is highly secreted by fibrosarcoma tumor cells; in addition, ectopic expression of IL-17D in tumor cells recruits natural killer cells via the CCL2 production of endothelial cells.
Bioactivity/Biological Activity
Testing in process
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close