« Back
Home /
Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

Swine recombinant CXCL13 (C-X-C motif chemokine 13) protein, AF

Item no.	BOS-PROTA0A287A706-5ug
Manufacturer	Boster
Amount	5 ug
Quantity options	20 ug 5 ug
Category	Oncology By Cell Type Hematology Lymphoma Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Pig (Porcine, Sus scrofa domesticus)
Conjugate/Tag	HIS
Sequence	VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA with polyhistidine tag at the N-terminus.
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 10.81 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 10.81 kDa.The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	CXCL13
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	C-X-C motif chemokine 13 (CXCL13) also named B lymphocyte chemoattractant (BLC), which is a chemokine of the intercrine alpha family. CXCL13 is a 9.8kDa protein containing 88 amino acid residues. CXCL13 is a chemotaxis for B lymphocyte. CXCL13 induces the cell proliferation though the AKT signal pathway which plays an key role intestinal cancer model. CXCL13 /CXCR5 axis is highly existed in gut, spleen and lymph nodes.
Bioactivity/Biological Activity	Testing in process
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTA0A287A706-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time