Comparison

Swine recombinant CXCL9 (C-X-C motif chemokine 9) protein, AF European Partner

Item no. BOS-PROTB0FYK2-5ug
Manufacturer Boster
Amount 5 ug
Quantity options 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Pig (Porcine, Sus scrofa domesticus)
Conjugate/Tag HIS
Sequence TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT with polyhistidine tag at the N-terminus.
Alias MIG
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 12.88 kDa.
The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 12.88 kDa.The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
CXCL9
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
C-X-C motif chemokine 9 (CXCL9) also named monokine induced by gamma interferon (MIG), which is a chemokine of the intercrine alpha family. CXCL9 is a 11.5 kDa protein containing 10? amino acid residues. CXCL9 controls the immune cells by binding the CXCR3 which is including the cell migration and activation. During inflammation, CXCL9 is a chemotaxis for lymphocyte and macrophages. CXCL9 is participated in the process of tumor proliferation and metastasis.
Bioactivity/Biological Activity
Testing in process
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close