« Back
Home /
Human recombinant EGF (Epidermal growth factor) protein, AF

Human recombinant EGF (Epidermal growth factor) protein, AF

Item no.	BOS-PROTP01133-5-500ug
Manufacturer	Boster
Amount	500 ug
Quantity options	1 mg 100 ug 500 ug 5 mg
Category	Oncology Neuroscience Neural Signaling By Cell Type Carcinoma Cell Biology Cell Culture Cytokines Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR with polyhistidine tag at the C-terminus
Alias	Urogastrone,URG
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 7.16 kDa. The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 7.16 kDa.The protein migrates as 9-11 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	EGF
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Human epidermal Growth Factors (EGF) is a 6 kDa cytokine with 53 amino acid residues. EGF is mainly secreted from ectodermal cells, monocytes, kidney and duodenal glands. Upon binding to its receptor, EGFR, EGF acts to stimulate cell growth and proliferation of epithelial cells, play important roles in many developmental processes including accelerate tooth eruption, inhibits gastric acid secretion, and involve in wound healing.
Bioactivity/Biological Activity	Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is < 1.0 ng/mL. The specific activity of recombinant human EGF is approximately >1.0 x 10⁶ IU/mg.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP01133-5-500ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time