Comparison

Human recombinant TGF alpha (Transforming growth factor alpha) protein, AF European Partner

Item no. BOS-PROTP01135-2
Manufacturer Boster
Amount 500 ug
Quantity options 500 ug 100 ug 20 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Sequence MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus.
Alias Sarcoma growth factor,TGF-type I,ETGF,TGFA
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 6.49 kDa.
The protein migrates as 7 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 6.49 kDa.The protein migrates as 7 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
TGFA
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a
concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least
20 mins to ensure sufficient re-dissolved. In some experiments, it recommends to add 10 mM HCl when reconstitute lyophilized protein. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Transforming Growth Factors alpha (TGF-α) is a 5.68 kDa member of the epidermal Growth Factors with 51 amino acid residues. TGF-α is mainly expressed from brain, skin, epithelial cell (pancreatic endocrine cells, urothelial cells, oligodendrocyte precursor cells, etc.). TGF-α is a regulator of cell proliferation and differentiation via bind to the EGFR and to act synergistically with TGF β. TGF-α also associates with myriad forms of cancer.
Bioactivity/Biological Activity
Measure by its ability to induce 3T3 cells proliferation.
The ED₅₀ for this effect is <0.2 ng/mL.
The specific activity of recombinant human TGF alpha is > 5 x 10⁶ IU/mg.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close