Comparison

Mouse recombinant IL-1 alpha (Interleukin-1 alpha) protein, AF European Partner

Item no. BOS-PROTP01582-6-5ug
Manufacturer Boster
Amount 5 ug
Quantity options 100 ug 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Mouse (Murine, Mus musculus)
Conjugate/Tag HIS
Sequence MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS with polyhistidine tag at the C-terminus.
Alias Hematopoietin-1,Lymphocyte-Activating Factor (LAF),Endogenous Pyrogen (EP),Leukocyte
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 18.93 kDa.
The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 18.93 kDa.The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
IL1A
Purification
>95% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Interleukin-1 alpha (IL1 alpha or IL1α) is a member of the interleukin-1 cytokine family, found constitutively present in epithelial layers of the entire gastrointestinal tract, lung, liver, kidney, endothelial cells, and astrocytes. The synthesized IL-1 alpha is a 31 kDa inactive precursor and can be cleaved by intracellular caspase-1 or extracellular proteases to generate the bioactive 17 kDa form and the 16 kDa N-terminal cleavage product. Both precursor and mature IL-1 alpha protein bind to the IL-1 receptor (IL-1R), initiating a cascade of inflammatory cytokines and chemokines production such as IL-6, IL-8, and TNF, in response to viral and bacterial pathogens conditions. IL-1 alpha plays a central role in immune-surveillance mechanisms, stimulating macrophages, neutrophils, and CD8+ T cells activity.
Bioactivity/Biological Activity
Measure by its ability to induce D10.G4.1 cells proliferation.
The ED₅₀ for this effect is <5 pg/mL.
The specific activity of recombinant mouse IL-1 alpha is > 2 x 10⁸ IU/mg.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close