« Back
Home /
Human recombinant IL-1 beta protein, GMP

Human recombinant IL-1 beta protein, GMP

Item no.	BOS-PROTP01584-6-1mg
Manufacturer	Boster
Amount	1 mg
Quantity options	100 ug 1 mg
Category	Neuroscience Neuroinflammation Metabolism Cholesterol & Lipid Metabolism Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines ELISA Immunostaining Cell Culture
Format	Lyophilized
Applications	ELISA, Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MASAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS with polyhistidine tag at the C-terminus.
Alias	interleukin 1 beta,Catabolin,Lymphocyte-Activating Factor (LAF),Endogenous Pyrogen (EP),Leukocyte Endogenous Mediator (LEM),Mononuclear Cell Factor (MCF),IL1,IL1B
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 18.5 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Calculated Molecular weight	The protein has a calculated MW of 18.5 kDa.The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IL1B
Purification	>98% as determined by SDS-PAGE analysis.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Description	Interleukin-1 beta (IL-1β) is a major cytokine expressed in macrophage, NK cells, monocytes, and neutrophils. It also plays fundamental role in inflammatory response, including monocyte activation, which is essential for the host defense and pathogen and pathogen resistance. Pro-IL-1β is cleaved by cytosolic caspase 1 to form mature IL-1β.
Bioactivity/Biological Activity	Measure by its ability to induce IL-8 secretion in HT29 cells. The ED₅₀ for this effect is <2.0 ng/mL. The specific activity of recombinant human IL-1 beta is approximately >3 x 10⁷ IU/mg, which is calibrated against the human IL-1 beta WHO International Standard (NIBSC code: 86/680).
Endotoxin level	<0.05 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP01584-6-1mg-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time