Comparison

Human recombinant IFN omega (interferon omega) protein, AF European Partner

Item no. BOS-PROTP05000-3-20ug
Manufacturer Boster
Amount 20 ug
Quantity options 500 ug 100 ug 20 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Sequence MCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS with polyhistidine tag at the C-terminus.
Alias IFN alpha II-1,IFNW1
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 20.93 kDa.
The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 20.93 kDa.The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
IFNW1
Purification
>95% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Interferon Omega (IFN-ω) is a 20.12 kDa member of type I IFN family with 173 amino acid residues. IL-28B is expressed by epithelial tissues. IFN-ω with antiviral, antitumor activity and regulating the innate immune response. Able to activate P13K/Akt signaling pathway via binding its receptor IFNAR in cells.
Bioactivity/Biological Activity
Measure by its ability to induce cytotoxicity in TF-1 cells.
The ED₅₀ for this effect is <0.02 ng/mL.
The specific activity of recombinant human IFN omega is approximately >5 x10⁷ IU/ mg.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close