« Back
Home /
Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Mouse recombinant IGF-I (Insulin-like growth factor-I) protein, AF

Item no.	BOS-PROTP05017-2
Manufacturer	Boster
Amount	500 ug
Quantity options	500 ug 100 ug 20 ug
Category	Oncology Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism By Cell Type Sarcoma Cell Biology Cell Culture Cytokines Endocrine Regulation of Lipid Metabolism Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Conjugate/Tag	HIS
Sequence	MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA with polyhistidine tag at the C-terminus.
Alias	Somatamedin C,IGF-IA
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 8.61 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 8.61 kDa.The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IGF1
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Insulin Like Growth Factors 1 (IGF-I) is a 7.81 kDa member of the Insulin-like Growth Factors with 71 amino acid residues. IGF-I is mainly expressed from liver, adipose tissue, cervi, endometrial stromal cells, leydig cells, and can be isolated from plasma. IGF-I is mediating the protein anabolic and promoting effect of pituitary growth hormone. IGF-I also affects metabolism of glycogen, DNA synthesis and glucose uptake via binding to IGF-I receptor.
Bioactivity/Biological Activity	Measure by its ability to induce MCF-7 cells proliferation. The ED₅₀ for this effect is <2 ng/mL. The specific activity of recombinant mouse IGF-I is > 5 x 10⁵ IU/mg.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP05017-2-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time