« Back
Home /
Human recombinant CCL3 (C-C motif chemokine ligand 3) protein, AF

Human recombinant CCL3 (C-C motif chemokine ligand 3) protein, AF

Item no.	BOS-PROTP10147-4
Manufacturer	Boster
Amount	100 ug
Quantity options	100 ug 20 ug 5 ug
Category	Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA with polyhistidine tag at the N-terminus
Alias	MIP-1a: Macrophage Inflammatory Protein-1α,LD78α
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 8.4 kDa. The protein migrates as 8-11 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1xPBS, pH 8.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 8.4 kDa.The protein migrates as 8-11 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	CCL3
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	C-C Motif Chemokine Ligand 3 (CCL3) is a 7.33Da cytokine with 66 amino acid residues. CCL3 is also called macrophage inflammatory protein 1-alpha (MIP-1-alpha) and is expressed in bone marrow and liver. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays an essential role in acute inflammatory responses like recruitment and activation of polymorphonuclear leukocytes and induction of monophasic fever. In addition, CCL3 participates in resistance to type 1 virus infection, mediation of MAPK signaling pathway, cell-cell signaling, and calcium-mediated signaling.
Bioactivity/Biological Activity	Measure by its ability to chemoattract human PBMC using a concentration range of 5 -50 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP10147-4-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time