Comparison

Mouse recombinant CXCL10 (C-X-C motif chemokine 10) protein, AF European Partner

Item no. BOS-PROTP17515-2-5ug
Manufacturer Boster
Amount 5 ug
Quantity options 100 ug 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Mouse (Murine, Mus musculus)
Conjugate/Tag HIS
Sequence IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP with polyhistidine tag at the N-terminus.
Alias IP-10,Gamma-Interferon Inducible Protein 10,Crg-2
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (N-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 9.47 kDa.
The protein migrates as 7-11 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 9.47 kDa.The protein migrates as 7-11 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
CXCL10
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
C-X-C motif chemokine 10 (CXCL10) also named Interferon gamma-induced protein 10 (IP-10), which is a chemokine of the intercrine alpha family. CXCL10 is a 8.55 kDa protein containing 77 amino acid residues. CXCL10 is produced by the several cell types like monocytes and endothelial cells, which are responsed for IFNγ. CXCL10 is a chemotaxis for T cells, NK cells and macrophages. CXCL10 also binds the CXCR3 that induces the cell migration and activation like T cells and dendritic cells.
Bioactivity/Biological Activity
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3.
The ED₅₀ for this effect is <0.2 μg/mL.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 2/3/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close