« Back
Home /
Human recombinant Pleiotrophin protein, AF

Human recombinant Pleiotrophin protein, AF

Item no.	BOS-PROTP21246-3-20ug
Manufacturer	Boster
Amount	20 ug
Quantity options	100 ug 20 ug 5 ug
Category	Neuroscience Molecular Targets for Neuroscience Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD with polyhistidine tag at the C-terminus.
Alias	PTN,Heparin Affin Regulatory Protein (HARP),Heparin-Binding Growth Factor-8 (HBGF-8),Osteoblast-Specific Factor 1 (OSF-1)
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 19.89 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 19.89 kDa.The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	PTN
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Pleiotrophin (PTN) also known as HB-GAM, which is a Growth Factors involves in widely range of biological events such as bone development, neural regeneration, inflammatory response, tissue repair. PTN is 18.9 kDa protein containing 168 residues that expressed in Osteoblast and brain. Besides, PTN has been revealed to suppress the long-term potentiation (LTP) in hippocampus and plays a critical role in modulating learning-related behavior. On the other hand, PTN also acts as an angiogenic factor that promotes tumor progression by PTN/Anaplastic Lymphoma Kinase (ALK) axis.
Bioactivity/Biological Activity	Testing in process
Endotoxin level	<0.01 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP21246-3-20ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time