Comparison

Human recombinant CD30L (CD30 ligand) protein, AF European Partner

Item no. BOS-PROTP32971-5-5ug
Manufacturer Boster
Amount 5 ug
Quantity options 100 ug 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Sequence MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.
Alias soluble CD30 Ligand,TNFSF8,CD153,sCD30 Ligand
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 20.57 kDa.
The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 20.57 kDa.The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
TNFSF8
Purification
>98% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Human CD30L is also named for CD153 and TNFSF8 which is one member of TNF family. Human CD30L is expressed on T cells. It binds the CD30, which is on some lymphoma cell lines. Human CD30L is a 30 kDa cytokine with 171 amino acid residues which is a transmembrane glycoprotein. Human CD30L plays an important role in the regulation of cell proliferation, activation and apoptosis. Human CD30L is a good target of cell therapy in inflammatory diseases.
Bioactivity/Biological Activity
Measure by its ability to induce IL-8 secretion in human PBMCs using a concentration range of 10 - 100 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5 ug
Available: In stock
available

Delivery expected until 12/4/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close