Comparison

Human recombinant GDNF (Glial-derived neurotrophic factor) protein, AF European Partner

Item no. BOS-PROTP39905-3
Manufacturer Boster
Amount 100 ug
Quantity options 100 ug 20 ug 5 ug
Category
Format Lyophilized
Applications Cell Culture
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Sequence MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI with polyhistidine tag at the C-terminus.
Alias ATF,ATF1,ATF2,HFB1-GDNF,HSCR3
Available
Manufacturer - Category
Recombinant Proteins
Manufacturer - Conjugate / Tag
His Tag (C-term)
Storage Conditions
Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight
The protein has a calculated MW of 16.01 kDa.
The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format
The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight
The protein has a calculated MW of 16.01 kDa.The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis).
Gene Name
GDNF
Purification
>95% as determined by SDS-PAGE.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description
Glial cell line-derived neurotrophic factor (GDNF) is the neurotrophic factor, belonging to the GDNF family of ligands (GFL) and identifying as a therapeutic candidate in Parkinson's disease. GDNF is a 23.7 kDa protein containing 211 residues that plays a critical role in promoting the survival and differentiation of midbrain dopamine neurons. Besides, GDNF is revealed to facilitate the development of peripheral tissues such as kidney, pancreas and lung. Additionally, as a member of GFL, GDNF also takes part in the progression of tumor.
Bioactivity/Biological Activity
Measure by its ability to induce proliferation in SH-SY5Y cells.
The ED₅₀ for this effect is <10 ng/mL.
Endotoxin level
<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close