« Back
Home /
Human recombinant IL-15 protein, GMP

Human recombinant IL-15 protein, GMP

Item no.	BOS-PROTP40933-6-100ug
Manufacturer	Boster
Amount	100 ug
Quantity options	100 ug 1 mg
Category	Cell Biology Cell Culture Cytokines ELISA Immunostaining Cell Culture
Format	Lyophilized
Applications	ELISA, Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFIN TSLE with polyhistidine tag at the N-terminus.
Alias	IL-T
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (N-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 13.7 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	Lyophilized from a 0.2 µm filtered solution of PBS, pH 8.0.
Calculated Molecular weight	The protein has a calculated MW of 13.7 kDa.The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IL15
Purification	>95% as determined by SDS-PAGE analysis.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 0.5 mg/mL and incubate the stock solution at RT for at least 20 min to ensure sufficient re-dissolved.
Description	Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.
Bioactivity/Biological Activity	Measure by its ability to induce proliferation in CTLL-2 cells. The ED₅₀ for this effect is < 3 ng/mL. The specific activity of recombinant human IL-15 is > 2 x 10⁶ IU/mg, which is calibrated against the human IL-15 WHO International Standard (NIBSC code: 95/554).
Endotoxin level	<0.05 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP40933-6-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time