« Back
Home /
Human recombinant 4-1BBL (4-1BB ligand) protein, AF

Human recombinant 4-1BBL (4-1BB ligand) protein, AF

Item no.	BOS-PROTP41273-3-5ug
Manufacturer	Boster
Amount	5 ug
Quantity options	100 ug 20 ug 5 ug
Category	Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE with polyhistidine tag at the C-terminus.
Alias	CD137L,TNLG5A,TNFSF9,Tumor necrosis factor ligand superfamily member 9
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 20.4 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 20.4 kDa.The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	TNFSF9
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	4-1BB ligand (4-1BBL) is a type II transmembrane protein that is part of the tumor necrosis factor (TNF) ligand family. As an inducible co-stimulatory molecule, it presents on several antigen presenting cell (APC) types, including B cells, macrophages and DCs. The interactions between 4-1BB and 4-1BBL trigger pleiotropic effects on the immune response including antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells through NFκB, c-Jun, and p38 downstream signal pathways activation. Therefore, 4-1BB and 4-1BBL are recently used for the immunotherapy of cancer.
Bioactivity/Biological Activity	Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is 1-5 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTP41273-3-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 12/4/2025

Compare

Add to wishlist

Get an offer

Request delivery time