« Back
Home /
Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF

Mouse recombinant VEGF121 (Vascular endothelial growth factor 121) protein, AF

Item no.	BOS-PROTQ00731-6
Manufacturer	Boster
Amount	100 ug
Quantity options	100 ug 20 ug 5 ug
Category	Oncology By Cell Type Carcinoma Cell Biology Cell Culture Cytokines Adenocarcinoma By Organ Bladder Cancer Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Mouse (Murine, Mus musculus)
Conjugate/Tag	HIS
Sequence	MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR with polyhistidine tag at the C-terminus.
Alias	VPF
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 15.01 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 15.01 kDa.The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	Vegfa
Purification	>95% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Vascular Endothelial Growth Factors 121 (VEGF121) is a truncated version of VEGF165, which produced in E. coli is a homodimer, non-glycosylated, polypeptide chain and having a molecular mass of 28.4 kDa. There is three different isoforms (120, 164 and 188 a.a.) found in mouse. VEGF 121 shows that lack basic heparin-binding regions and are freely diffusible. Mouse VEGF121 shares 98% identity with corresponding regions of rat, 89% with canine, feline, equine and porcine, and 87% with human, ovine and bovine VEGF, respectively.
Bioactivity/Biological Activity	Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <3 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTQ00731-6-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer