« Back
Home /
Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

Human recombinant IL-36 beta (Interleukin-36 beta) protein, AF

Item no.	BOS-PROTQ9NZH7-3
Manufacturer	Boster
Amount	100 ug
Quantity options	100 ug 20 ug 5 ug
Category	Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE with polyhistidine tag at the C-terminus.
Alias	IL-1F8,IL-1H2,IL-1 eta
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 18.17 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 18.17 kDa.The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	IL36B
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF).
Bioactivity/Biological Activity	Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTQ9NZH7-3-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 12/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer