« Back
Home /
Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF

Human recombinant AITRL (Activation-induced TNFR member ligand) protein, AF

Item no.	BOS-PROTQ9UNG2-7-5ug
Manufacturer	Boster
Amount	5 ug
Quantity options	100 ug 20 ug 5 ug
Category	Cell Culture
Format	Lyophilized
Applications	Cell Culture
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Sequence	MQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGII LIANPQEI with polyhistidine tag at the C-terminus.
Alias	TL6,GITRL,TNLG2A,hGITRL,TNFSF18
Available
Manufacturer - Category	Recombinant Proteins
Manufacturer - Conjugate / Tag	His Tag (C-term)
Storage Conditions	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Molecular Weight	The protein has a calculated MW of 15.34 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Manufacturer - Format	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Calculated Molecular weight	The protein has a calculated MW of 15.34 kDa.The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Gene Name	TNFSF18
Purification	>98% as determined by SDS-PAGE.
Reconstitution	Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Description	AITRL also known as TNFSF18, GITRL and TL6, belonging to TNF superfamily. AITRL is a 20.3 kDa protein containing 177 residues that implicates in regulating immune systems. AITRL contributes to tumor suppression and the development of autoimmune diseases via interacting with TNFRSF18/AITR/GITR. Besides, AITRL-GITR signaling has been demonstrated to enhance phosphorylation of STAT1 and up-regulate expression of VCAM1 and ICAM1 in endothelial cells. Furthermore, AITRL can also facilitate the adhesion and transmigration of leukocytes to endothelial cells.
Bioactivity/Biological Activity	Measure by its ability to induce IL-8 secretion in human PBMC using a concentration range of 5-200 ng /mL. Note: Result may vary from different PBMC donors.
Endotoxin level	<0.1 EU per 1 μg of the protein by the LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-PROTQ9UNG2-7-5ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 5 ug

available

Delivery expected until 12/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer