Comparison

SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag European Partner

Item no. BOS-RCOV03
Manufacturer Boster
Amount 100 ug/vial
Quantity options 100 ug/vial
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
Conjugate/Tag HIS
Sequence NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SARS-CoV-2,COVID-19,2019-nCov,coronavirus,NSP9,Nonstructural Protein 9
Available
Manufacturer - Category
Recombinant Proteins
Storage Conditions
The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular weight
13.2KD
Contents
Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Purification
> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining.
Method of purification: Nickel column affinity purification
Description
SARS-CoV-2 (COVID-19) NSP9 Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 13.2KD. This product is for research use only. Product is under validation for additional applications and indications.
Endotoxin level
Less than 1 EU/μg protein as determined by LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug/vial
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?