« Back
Home /
Recombinant Hirudo medicinalis Hirudin variant-1

Recombinant Hirudo medicinalis Hirudin variant-1

Item no.	CSB-RP182644Ba-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGE KNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Citations	Role of interactions involving C-terminal nonpolar residues of hirudin in the formation of the thrombin-hirudin complex.Betz A., Hofsteenge J., Stone S.R.Biochemistry 30:9848-9853(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Specificity	Hirudo medicinalis (Medicinal leech)
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 34
Buffer	Tris-based buffer, 50% glycerol
Relevance	Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.
Expression Region	1-65aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Sequence Info	Full Length
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer