« Back
Home /
P23/PTGES3 Rabbit pAb

P23/PTGES3 Rabbit pAb

Item no.	A5325-200ul
Manufacturer	Abclonal
Amount	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category	Metabolism Cholesterol & Lipid Metabolism Antibodies Immunohistochemistry Western Blot Enzymes Prostaglandin Synthases Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
NCBI	PTGES3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P23, TEBP, cPGES, P23/PTGES3
Similar products	PTGES3
Shipping Condition	Cool pack
Available
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background	This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/P23/PTGES3 (NP_006592.3).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	19kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A5325-200ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ul

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer