« Back
Home /
Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10)

Item no.	BM-RPC20741-50ug
Manufacturer	Biomatik
Amount	50 UG
Category	Peptides & Proteins Recombinant Proteins Cardiovascular Research Ischemia & Reperfusion Injury
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDG RSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLL FSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANH TPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEEC PLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKR AETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIG CQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASD SPF
Protein Family	Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ10 subfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel, inwardly rectifying subfamily J member 10
Similar products	inwardly rectifying subfamily J member 10, ATP-dependent inwardly rectifying potassium channel Kir4.1 Inward rectifier K(+) channel Kir1.2 Potassium channel
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	58.5 kDa
Expression Region	1-379aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K+ recycling in distal tubules; this process is critical for Na+ reabsorption at the tubules
Subcellular location	Membrane, Multi-pass membrane protein, Basolateral cell membrane
Involvement in disease	Seizures, sensorineural deafness, ataxia, mental retardation, and electrolyte imbalance (SESAMES)
Function	May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium (By similarity). In the kidney, together with KCNJ16, mediates basolateral K(+) recycling in distal tubules; this process is critical for Na(+) reabsorption at the tubules.
Activity	Not Tested
Tissue Specificity	Expressed in kidney (at protein level).
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	KCNJ10
Sequence Information	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 UG

available

Delivery expected until 11/13/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer