Comparison

OLFM3 Rabbit pAb European Partner

Item no. A17293-100ul
Manufacturer Abclonal
Amount 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Affinity purification
Sequence HQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
NCBI Olfm3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias B230206G02Rik, OLFM3
Similar products Olfm3, OLFM3, B230206G02Rik, noelin-3
Shipping Condition Cool pack
Available
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
Predicted to be involved in eye photoreceptor cell development. Located in Golgi apparatus and extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; eye; and head. Orthologous to human OLFM3 (olfactomedin 3).
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse OLFM3 (NP_694797.1).
Recommended Dilution
WB, 1:500 - 1:2000
Route
Synthetic peptide

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close