« Back
Home /
Recombinant Mouse Beta-tectorin (Tectb)

Recombinant Mouse Beta-tectorin (Tectb)

Item no.	BM-RPC20608-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Sequence	KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQ LALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQ SEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCT YHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSL NFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKG LSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPT DETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWL HCE
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	36.5 kDa
Expression Region	18-305aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.
Subcellular location	Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, Secreted, extracellular space, extracellular matrix
Function	One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Manufacturer - Gene Name	Tectb
Sequence Information	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 10/16/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer