« Back
Home /
Recombinant Mouse Pericentrin (Pcnt), partial

Recombinant Mouse Pericentrin (Pcnt), partial

Item no.	BM-RPC26302-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Pcnt2
Similar products	Pcnt2
Available
Gene Name	Pcnt
Alternative Names	Pcnt2
Uniprot	P48725
Source	E.coli
Expression Region	2545-2810aa
AA Sequence	LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMR TLEELKSELSMPTSFQKKMTAELQVQLMNELLSDN DALTKAVGMATREKAELCRTVSRLEKTLKHHTQKG CVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTS GDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLL LLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSR PFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALV HPKSTRHGHRTSQRQRSPSGP
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	37.7 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material. May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer