« Back
Home /
Recombinant Human Fibroblast growth factor 19(FGF19),partial

Recombinant Human Fibroblast growth factor 19(FGF19),partial

Item no.	CSB-AP003911HU-1
Manufacturer	Cusabio
Amount	1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by SDS-PAGE.
Sequence	FSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLR IRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVH SVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGY NVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFL PMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFG LVTGLEAVRSPSFEK
Protein Family	Heparin-binding growth factors family
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fibroblast growth factor 19; FGF-19; FGF19
Available
Manufacturer - Category	Cytokine / Growth Factor
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Molecular Weight	23.5 kDa
General Research Areas	Signal Transduction
Relevance	Fibroblast growth factor 19 (FGF19) is a secreted protein which belongs to the FGFs family. FGF19 is expressed in fetal brain, cartilage, retina, and adult gall bladder. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity. FGFRs can be important for regulation of glucose and lipid homeostasis. FGF19 has important roles as a hormone produced in the ileum in response to bile acid absorption. It has been shown to cause resistance to diet-induced obesity and insulin desensitization and to improve insulin, glucose, and lipid profiles in diabetic rodents. FGF19 can be considered as a regulator of energy expenditure.
Function	Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression, following positive regulation of the JNK and ERK1/2 cascades. Stimulates glucose uptake in adipocytes. Activity requires the presence of KLB and FGFR4.
Subcellular Location	Secreted
Tissue Specificity	Expressed in fetal brain, cartilage, retina, and adult gall bladder.
Paythway	MAPKsignalingpathway
Gene Names	FGF19
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Expression Region	27-216aa
Protein Description	Partial
Biological Activity	The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 15 ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-AP003911HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

not available