« Back
Home /
Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

Item no.	CSB-CF868343HU
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	Q9NX14
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDE NLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSII LVLGSTFVAYLPDYRMKEWSRREAERLVKYREANG LPIMESNCFDPSKIQL PEDE
Protein Names	Recommended name = NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Alternative name(s):Complex I-ESSS Short name = CI-ESSS NADH-ubiquinone oxidoreductase ESSS subunit Neuronal protein 17.3 Short name =
Gene Names	Name:NDUFB11 ORF Names: UNQ111/PRO1064
Expression Region	30-153
Sequence Info	full length protein
Species info	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer