« Back
Home /
Recombinant human Cytochrome c oxidase subunit 5B, mitochondrial

Recombinant human Cytochrome c oxidase subunit 5B, mitochondrial

Item no.	CSB-RP004044h-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot ID	P10606
Gene Names	COX5B
AA sequence	ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLA PKGASGTREDPNLVPSISNKRIVGCICEEDNTSVV WFWLHKGEAQRCPRCGAHYKLVPQQLAH
Tag Info	GST-tag
Expression Region	32-129aa
MW	38kD
Sequence Info	Full length
Research area	Metabolism

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer