« Back
Home /
Recombinant Mouse Tumor necrosis factor ligand superfamily member 6(Faslg)

Recombinant Mouse Tumor necrosis factor ligand superfamily member 6(Faslg)

Item no.	CSB-CF008434MO
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	P41047
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSC GPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPL KKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHL QKELAELREFTNQSLKVSSFEKQIANPSTPSEKKE PRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYK KGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVY MRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGA VFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
Protein Names	Recommended name = Tumor necrosis factor ligand superfamily member 6 Alternative name(s):CD95 ligand Short name = CD95-L Fas antigen ligand Short name = Fas ligand Short name = FasL CD_antigen = CD178 Cleaved into the following 4 chains: 1. Tumor necrosis factor ligand superfamily member 6, membrane form 2. Tumor necrosis factor ligand superfamily member 6, soluble form Alternative name(s):Receptor-binding FasL ectodomain Soluble Fas ligand Short name = sFasL ADAM10-processed FasL form Short name = APL FasL intracellular domain Short name = FasL ICD Alternative name(s):SPPL2A-processed FasL form Short name = SPA
Gene Names	Name:Faslg Synonyms:Apt1lg1, Cd95l, Fasl, gld, Tnfsf6
Expression Region	1-279
Sequence Info	full length protein
Species info	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer