« Back
Home /
Recombinant Solanum lycopersicum Photosystem II reaction center protein H(psbH)

Recombinant Solanum lycopersicum Photosystem II reaction center protein H(psbH)

Item no.	CSB-CF643581SZY
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Recombinant Proteins
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Uniprot NO.	Q2MI72
Tag Info	His-SUMO-tag
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	Store at -20C, for extended storage, conserve at -20C or -80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence	ATQTVENSSRSGPRRTAVGDLLKPLNSEYGKVAPG WGTTPLMGVAMALFAVFLSIILEIY NSSVLLDGI SMN
Protein Names	Recommended name = Photosystem II reaction center protein H Short name = PSII-H Alternative name(s):Photosystem II 10 kDa phosphoprotein
Gene Names	Name:psbH
Expression Region	2-73
Sequence Info	full length protein
Species info	Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer