Comparison

Recombinant Oryza sativa subsp. japonica E3 ubiquitin-protein ligase Os04g0590900(Os04g0590900, LOC_Os04g50100)

Item no. CSB-CF770276OFG
Manufacturer Cusabio
Amount 10ug
Category
Type Recombinant Proteins
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Uniprot NO.
Q7XLY8
Tag Info
His-SUMO-tag
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
Store at -20C, for extended storage, conserve at -20C or -80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
AA sequence
MASSAPAWVPYEPTRDCSQGLCSMYCPQWCYFIFP PPPPFDVAGTSADDSSGPVFSPLVI AIIGVLASA FLLVSYYTFISKYCGTVSSLRGRVFGSSSGGAAYG GGAGSGGRHGHGQSRS HESWNVSPPSGLDETLIN KITVCKYRRGDGFVHTTDCSVCLGEFSDGESLRLL PRCSHAF HQQCIDTWLKSHSNCPLCRANITFVTV GLASPEPEGCAPGETGGDNTHEVVVVMDGLENL C EEQQEAVSRASTADDDHDAKDVAEGMEEANGAAEI REEGSPPKRGASSFDLHRDNRMCI ADVLQESMED ELTAARESGLLAGGAGTSRRCHGENSKGRGGRSRR ALQLQDAMEALPGKR LPSGGRSCFSSKSGRGKDS DHPM
Protein Names
Recommended name = E3 ubiquitin-protein ligase Os04g0590900
EC = 6.3.2.-
Alternative name(s):RING-H2 finger protein Os04g0590900
Gene Names
Ordered Locus Names: Os04g0590900, LOC_Os04g50100
ORF Names: OsJ_15972, OSJNBa0086O06.21
Expression Region
1-383
Sequence Info
full length protein
Species info
Oryza sativa subsp. japonica (Rice)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10ug
Available: In stock
available

Delivery expected until 11/20/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close