Comparison

Recombinant Human Laminin subunit beta-1(LAMB1),partial

Item no. CSB-RP142974h-200
Manufacturer Cusabio
Amount 200 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MPSTPQQLQNLTEDIRERVESLSQVEVILQHSAAD IARAEMLLEEAKRASKSATDVKVTADMVKEALEEA EKAQVAAEKAIKQADEDIQGTQNLLTSIESETAAS EETLFNASQRISELERNVEELKRKAAQNSGEAEYI EKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAK KTEESADARRKAEMLQNEAKTLLAQANSKLQLLKD LERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQ KVA
Citations Isolation of a cDNA clone for the human laminin-B1 chain and its gene localization.Jaye M., Modi W.S., Ricca G.A., Mudd R., Chiu I.M., O'Brien S.J., Drohan W.N.Am. J. Hum. Genet. 41:605-615(1987)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Laminin B1 chain;Laminin-1 subunit beta;Laminin-10 subunit beta;Laminin-12 subunit beta;Laminin-2 subunit beta;Laminin-6 subunit beta;Laminin-8 subunit beta
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
MW of Fusion: 32, 2
General Research Areas
Cell Adhesion
Relevance
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during bryonic development by interacting with other Extracellular domain matrix components. Involved in the organization of the laminar architecture of cerebral cortex. It is probably required for the integrity of the basent mbrane/glia limitans that serves as an anchor point for the endfeet of radial glial cells and as a physical barrier to migrating neurons. Radial glial cells play a central role in cerebral cortical development, where they act both as the proliferative unit of the cerebral cortex and a scaffold for neurons migrating toward the pial surface.
Expression Region
1533-1782aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
LAMB1
Sequence Info
Partial
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

 
Close