« Back
Home /
Neuropeptide Y (3-36), human

Neuropeptide Y (3-36), human

Item no.	RP10491-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Metabolism Glucose Homeostasis Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Obesity Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 ; {SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA}{PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU}{ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10491-Neuropeptide_Y_3-36_NPY_human, Neuropeptide Y 3-36 (NPY 3-36) is an endogenous neuropeptide that selectively binds to Y2 and Y5 receptors. NPY 3-36 accounts for 35% of NPY-like immunoreactivity in the porcine brain. NPY 3-36 has about 1/1000 the affinity of NPY 1-36 for Y1-like receptors on SK-N-MC cells. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Neuropeptide
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Neuropeptide Y 3-36 (NPY 3-36) is an endogenous neuropeptide that selectively binds to Y2 and Y5 receptors. NPY 3-36 accounts for 35% of NPY-like immunoreactivity in the porcine brain. NPY 3-36 has about 1/1000 the affinity of NPY 1-36 for Y1-like receptors on SK-N-MC cells.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer