Comparison

β-Amyloid (1-40) European Partner

Item no. RP10004-1
Manufacturer GenScript
Amount 1 mg
Quantity options 0.5 mg 1 mg
Category
Type Peptides
Specific against other
Purity > 95%
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ; {ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10004-beta-Amyloid_1-40_beta-APP,Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome,which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain,followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region. </td></tr><tr><th>Solubility</th><td colspan="7">Insoluble in water,may be dissolved in any buffer of pH >9. </td></tr><tr><th>Purity</th><td colspan="7">> 95% </td></tr><tr><th>Storage</th><td colspan="7">Store at -20C </td></tr><tr><th>Notes</th><td colspan="7">In culture,beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons,it causes dendritic and axonal retraction followed by neuronal death.</td></tr>
Similar products beta-Amyloid
Shipping Condition Room temperature
Available
Manufacturer - Category
Peptide/Catalog Peptides/Catalog Peptides
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Other Peptides
Description
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Solubility
Insoluble in water, may be dissolved in any buffer of pH >9.
Notes
In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?