« Back
Home /
Exendin-3

Exendin-3

Item no.	RP10873-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides By Organ Pancreatic Cancer
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 ; {HIS}{SER}{ASP}{GLY}{THR}{PHE}{THR}{SER}{ASP}{LEU}{SER}{LYS}{GLN}{MET}{GLU}{GLU}{GLU}{ALA}{VAL}{ARG}{LEU}{PHE}{ILE}{GLU}{TRP}{LEU}{LYS}{ASN}{GLY}{GLY}{PRO}{SER}{SER}{GLY}{ALA}{PRO}{PRO}{PRO}{SER}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10873-Exendin-3, Exendin-3, which is a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. Exendin-3 interacts with at least two receptors on guinea pig pancreatic acini. Exendin-3 stimulates amylase release and causes an increase in cellular cAMP at higher concentrations while it increases pancreatic acinar cAMP at lower concentrations. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr><tr><th>Notes</th><td colspan="7"> Pancreatic secretagogue.</td></tr>
Similar products	Exendin-3
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Exendin-3, which is a novel peptide from Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. Exendin-3 interacts with at least two receptors on guinea pig pancreatic acini. Exendin-3 stimulates amylase release and causes an increase in cellular cAMP at higher concentrations while it increases pancreatic acinar cAMP at lower concentrations.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Notes	Pancreatic secretagogue.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer