Comparison

beta-Amyloid (1-36) European Partner

Item no. RP20139
Manufacturer GenScript
Amount 0.5 mg
Category
Type Peptides
Specific against other
Purity >95%
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV ; {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP20139-beta-Amyloid_1-36, This is a fragment of beta-amyloid peptide. It has amino acids 1 through 36. </td></tr><tr><th>Purity</th><td colspan="7"> >95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products beta-Amyloid
Available
Country of Origin
USA
Storage Conditions
Store at -20C. Keep tightly closed. Store in a cool dry place.
Description
This is a fragment of beta-amyloid peptide. It has amino acids 1 through 36.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close