Comparison

sCD40L, Human European Partner

Item no. Z02727-50
Manufacturer GenScript
Amount 50 ug
Quantity options 1 mg 50 ug
Category
Type Proteins
Format Lyophilized
Specific against Human (Homo sapiens)
Purity >95% by SDS-PAGE and HPLC analyses.
Sequence MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02727-soluble_CD40_Ligand_sCD40L_Human,CD40 ligand,CD40L (also known as CD154,TRAP or gp39),is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family,CD40L is expressed predominantly on activated CD4+ T lymphocytes,and also found in other types of cells,like NK cells,mast cells,basophils and eosinophils. Human CD40L shares 78% amino acid identity with its mouse counterpart. The receptor of CD40L is CD40,a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes,monocytes,dendritic cells and thymic epithelium. Although all monomeric,dimeric and trimeric forms of soluble CD40L can bind to CD40,the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40,a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen,entry into cell cycle,isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.</td></tr><tr><th>M.W.</th><td colspan="7">Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.</td></tr><tr><th>Purity</th><td colspan="7">>95% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7">Less than 0.2EU/ug of rHusCD40L as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7">Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml,corresponding to a specific activity of 3.3 × 102 IU/mg in the presence of 20ng/ml rHuIL4.</td></tr><tr><th>Storage</th><td colspan="7">This lyophilized preparation is stable at 2-8 C,but should be kept at -20 C for long term storage,preferably desiccated. Upon reconstitution,the preparation is stable for up to one week at 2-8 C. For maximal stability,apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7">Lyophilized from a 0.2um filtered concentrated solution in PBS,pH 7.0.</td></tr><tr><th>Reconstitution</th><td colspan="7">We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7">Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7">This material is for research,laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7">MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNL VTLENGKQLT VKRQGLYYIY AQVTFCSNRE ASSQAPFIAS LWLKSPGRFE RILLRAANTH SSAKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL</td></tr>
Similar products soluble
Shipping Condition Cool pack
Available
Manufacturer - Category
Proteins/Cytokines
Country of Origin
USA
Shipping Temperature
4°C
Storage Conditions
-80°C
Molecular Weight
Approximately 16.3 kDa. a single non-glycosylated polypeptide chain containing 149 amino acids.
Product Line
Cytokines
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using B cell-enriched peripheral blood mononuclear cells (PBMC) is less than 3000 ng/ml, corresponding to a specific activity of 3.3 x 102 IU/mg in the presence of 20ng/ml rHuIL4.
Description
CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its mouse counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.0.
Endotoxin Level
Less than 0.2EU/ug of rHusCD40L as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close