Comparison

ENA-78/CXCL5 (5-78aa), Human European Partner

Item no. Z02820-1
Manufacturer GenScript
Amount 1 mg
Quantity options 1 mg 20 ug
Category
Type Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02820-ENA-78_CXCL5_5-78a.a._Human, Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.</td></tr><tr><th>M.W.</th><td colspan="7"> 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuENA-78/CXCL5 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml, corresponding to a specific activity of &
Similar products ENA-78/CXCL5
Available
Specificity Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml, corresponding to a specific activity of >, 1.0 x 105 IU/mg.
Country of Origin
USA
Storage Conditions
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight
8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids.
Product Line
Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml, corresponding to a specific activity of >, 1.0 x 105 IU/mg.
Description
Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH 7.4, 50mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuENA-78/CXCL5 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close