Comparison

NAP-2/CXCL7, Human European Partner

Item no. Z02821-10
Manufacturer GenScript
Amount 10 ug
Quantity options 1 mg 10 ug
Category
Type Proteins
Format Lyophilized
Specific against Human (Homo sapiens)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02821-NAP-2_CXCL7_Human,Neutrophil Activating Peptide 2 (NAP-2) is proteolytically processed carboxyl-terminal fragments of platelet basic protein (PBP) which is found in the alpha-granules of human platelets. NAP-2 is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins,NAP-2 has been shown to bind CXCR-2 and to chemoattract and activate neutrophils. Although CTAP-III,ß-TG and PBP represent amino-terminal extended variants of NAP-2 and possess the same CXC chemokine domains,these proteins do not exhibit NAP-2 activity. Recently,it has been shown that the additional amino-terminal residues of CTAP-III masks the critical ELR receptor binding domain that is exposed on NAP-2 and may account for lack of NAP-2 activity.</td></tr><tr><th>M.W.</th><td colspan="7">7.6 kDa,a single non-glycosylated polypeptide chain containing 70 amino acids.</td></tr><tr><th>Purity</th><td colspan="7">>97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7">Less than 0.2EU/ug of rHuNAP-2/CXCL7 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7">Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml,corresponding to a specific activity of &
Similar products NAP-2
Shipping Condition Cool pack
Available
Manufacturer - Category
Proteins/Chemokines
Country of Origin
USA
Shipping Temperature
4°C
Storage Conditions
-80°C
Molecular Weight
7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
Product Line
Chemokines
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human peripheral blood neutrophils is less than 10 ng/ml, corresponding to a specific activity of >, 1.0 x 105 IU/mg.
Description
Neutrophil Activating Peptide 2 (NAP-2) is proteolytically processed carboxyl-terminal fragments of platelet basic protein (PBP) which is found in the alpha-granules of human platelets. NAP-2 is a member of the CXC chemokines. Similar to other ELR domain containing CXC chemokines such as IL-8 and the GRO proteins, NAP-2 has been shown to bind CXCR-2 and to chemoattract and activate neutrophils. Although CTAP-III, ß-TG and PBP represent amino-terminal extended variants of NAP-2 and possess the same CXC chemokine domains, these proteins do not exhibit NAP-2 activity. Recently, it has been shown that the additional amino-terminal residues of CTAP-III masks the critical ELR receptor binding domain that is exposed on NAP-2 and may account for lack of NAP-2 activity.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuNAP-2/CXCL7 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Delivery expected until 2/19/2026 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close