Comparison

Fractalkine/CX3CL1, Human European Partner

Item no. Z02828-20
Manufacturer GenScript
Amount 20 ug
Quantity options 1 mg 20 ug
Category
Type Proteins
Format Lyophilized
Specific against Human (Homo sapiens)
Purity >97% by SDS-PAGE and HPLC analyses.
Sequence QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02828-Fractalkine_CX3CL1_Human,Fractalkine,also named neurotactin,is a novel chemokine recently identified through bioinformatics. Fractalkine has a unique C-X3-C cysteine motif near the amino-terminus and is the first member of a fourth branch of the chemokine superfamily. Unlike other known chemokines,fractalkine is a type 1 membrane protein containing a chemokine domain tethered on a long mucin-like stalk. Human fractalkine cDNA encodes a 397 amino acid (aa) residue membrane protein with a 24 aa residue predicted signal peptide,a 76 aa residue chemokine domain,a 241 aa residue stalk region containing 17 degenerate mucin-like repeats,a 19 aa residue transmembrane segment and a 37 aa residue cytoplasmic domain. The extracellular domain of human fractalkine can be released,possibly by proteolysis at the dibasic cleavage site proximal to the membrane,to generate soluble fractalkine. The soluble chemokine domain of human fractalkine was reported to be chemotactic for T cells and monocytes while the soluble chemokine domain of mouse fractalkine was reported to chemoattract neutrophils and T-lymphocytes but not monocytes.</td></tr><tr><th>M.W.</th><td colspan="7">8.5 kDa,a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Human Fractalkine.</td></tr><tr><th>Purity</th><td colspan="7">>97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7">Less than 0.2EU/ug of rHuFractalkine/CX3CL1 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7">Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml,corresponding to a specific activity of &
Similar products Fractalkine/CX3CL1
Shipping Condition Cool pack
Available
Manufacturer - Category
Proteins/Chemokines
Country of Origin
USA
Shipping Temperature
4°C
Storage Conditions
-80°C
Molecular Weight
8.5 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids and comprises only the chemokine domain of Human Fractalkine.
Product Line
Chemokines
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml, corresponding to a specific activity of >, 1.0 x 105 IU/mg.
Description
Fractalkine, also named neurotactin, is a novel chemokine recently identified through bioinformatics. Fractalkine has a unique C-X3-C cysteine motif near the amino-terminus and is the first member of a fourth branch of the chemokine superfamily. Unlike other known chemokines, fractalkine is a type 1 membrane protein containing a chemokine domain tethered on a long mucin-like stalk. Human fractalkine cDNA encodes a 397 amino acid (aa) residue membrane protein with a 24 aa residue predicted signal peptide, a 76 aa residue chemokine domain, a 241 aa residue stalk region containing 17 degenerate mucin-like repeats, a 19 aa residue transmembrane segment and a 37 aa residue cytoplasmic domain. The extracellular domain of human fractalkine can be released, possibly by proteolysis at the dibasic cleavage site proximal to the membrane, to generate soluble fractalkine. The soluble chemokine domain of human fractalkine was reported to be chemotactic for T cells and monocytes while the soluble chemokine domain of mouse fractalkine was reported to chemoattract neutrophils and T-lymphocytes but not monocytes.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH 7.4, 50mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuFractalkine/CX3CL1 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close