« Back
Home /
MIP-4/CCL18, Human

MIP-4/CCL18, Human

Item no.	Z02841-1
Manufacturer	GenScript
Amount	1 mg
Quantity options	1 mg 10 ug
Category	Oncology Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Culture Cytokines Cell Migration & Invasion By Organ Lung Cancer
Type	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human (Homo sapiens)
Purity	>97% by SDS-PAGE and HPLC analyses.
Sequence	AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02841-MIP-4_CCL18_Human, CCL18, is a novel CC chemokine that is highly homologous to MIP-1ª (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-I³. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils.</td></tr><tr><th>M.W.</th><td colspan="7"> 7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >97% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMIP-4/CCL18 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml, corresponding to a specific activity of &
Similar products	MIP-4/CCL18
Shipping Condition	Cool pack
Available
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml, corresponding to a specific activity of ＞, 1.0 x 105 IU/mg.
Manufacturer - Category	Proteins
Country of Origin	USA
Shipping Temperature	4°C
Storage Conditions	-80°C
Molecular Weight	7.8 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids.
Product Line	Chemokines
Manufacturer - Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human T-lymphocytes is less than 10 ng/ml, corresponding to a specific activity of ＞, 1.0 x 105 IU/mg.
Description	CCL18, is a novel CC chemokine that is highly homologous to MIP-1ª (61% amino acid sequence identity). CCL18 cDNA encodes an 89 aa residue precursor protein with a 20 aa putative signal peptide that is cleaved to generate a 69 aa residue mature protein which lacks potential glycosylation sites. In vitro, CCL18 mRNA expression is induced in alternatively activated macrophages by Th2 cytokines such as IL-4, IL-10 and IL-13, and inhibited by IFN-I³. CCL18 mRNA is also expressed by GM-CSF/IL-4-induced monocyte-derived dendritic cells. In vivo, CCL18 is highly expressed in lung and placenta but is not expressed in epidermal Langerhans cells. Recombinant CCL18 has been shown to chemoattract naive T cells, but not monocytes or neutrophils.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated, solution in 20mM PB, pH 7.4, 100mM NaCl.
Endotoxin Level	Less than 0.2EU/ug of rHuMIP-4/CCL18 as determined by LAL method.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Z02841-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer