TFAM (transcription factor A. mitochondrial)

TFAM is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Gene Symbol: Tfam

0. 5 microg/ml IHC: 4-8ug/ml

Synthetic peptide sequence derived from: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE

Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. Studies in mice have demonstrated that this protein is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression of the gene was eliminated by targeted disruption in heart and muscle cells.

Interacts with TFB1M and TFB2M (By similarity).

The mitochondrial isoform is widely expressed while the nuclear isoform is testis-specific.